DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-f2

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster


Alignment Length:446 Identity:141/446 - (31%)
Similarity:217/446 - (48%) Gaps:56/446 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLLLLWAVSALANDNLRVAYEWREMDFKYANPDQRWSAIER-------------GEFK------- 51
            ||.||....|   |.:...:.|::||| |...|...|:..|             |::.       
  Fly    14 GLQLLSLADA---DPMIEVFRWKQMDF-YNRGDGHLSSGGRKDRPSFSAPVVFPGKYSRRKRKIM 74

  Fly    52 -----------------------PANVIPFGLEVAGHRLFVTLPRWRDGVPASLAYLDL-NDTSS 92
                                   |.|.:|.|......|||||:||.|.|:|::|.|:|| .|.|:
  Fly    75 TSRDTPVVVSSRADSDDPNASYIPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAEDGSN 139

  Fly    93 KGPALKPFPSWQAHNLQEAEPELVSPFRVRADRCGRLWVLDSRISGVLE---QTKIYGAAQLLVY 154
            :.|.|:.:|::..:....:...|||.:|...|.|.|||.:|   :|:||   ..:......:.|.
  Fly   140 RSPKLRAYPNFALNQFNASAENLVSVYRTSVDACQRLWFID---TGMLEYPNNRQQIRRPSIWVV 201

  Fly   155 DLHNDDLLRRHVLPAGQLKQGSLLANLAVE--DSDCENTFAYAADLGSPGLVVYSWKDEESWRVQ 217
            ||..|.:|:|..:|....:.|..||::.|:  ...|.:.:||..||....|.||..:::..|..:
  Fly   202 DLATDQVLKRFDVPESIAETGRGLASITVDVKAGQCGDAYAYIPDLVYRRLYVYHLRNDRIWSFE 266

  Fly   218 HHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEFSVDTSILRNKTL 282
            |::|:.||::|:.||.|..|:||||::.:.|......|....||||:.||.||.|...:|:.::.
  Fly   267 HNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQKLDGSRDAYFHPMASTNEFVVSNRVLQQESN 331

  Fly   283 ATSPMIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVACWRTATDFSHSSQSRIHMNN 347
            |.......:|:|||||||:||:.....||.|||:|:.....|.|.||:|:...|..:...:..|.
  Fly   332 AARSDHGNDFRVLGSRGPSTQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKPISAENYGSVDSNA 396

  Fly   348 DTLVFPSDIKVDDQKRLWVLSNQLPVFIYDELYAGSINFRILTASVKEAIENTACE 403
            :.:::|||:.:|:...:||:||.:|:|||..|.....||||.......|...|.||
  Fly   397 EDMIYPSDLSIDEDGTIWVMSNSMPIFIYSTLDTSIYNFRIWKQKASLAKRGTVCE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 100/290 (34%)
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 100/290 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.