DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-k

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:318 Identity:71/318 - (22%)
Similarity:121/318 - (38%) Gaps:58/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SLAYLDLNDTSSKGPAL-----------KP---FPSWQAHNLQEAEP-ELVSPFR-VRADRCGRL 129
            |..:|.:|..|:..|.|           .|   ||....|::.:.:. .||.... .:.|...||
  Fly    45 SRVFLSVNVESNDAPTLIEAQWPVSYFPMPTVVFPHIDVHSMGDHDDCSLVQQAHWSQVDALSRL 109

  Fly   130 WVLDSRISGVLEQTKIYGAAQLLVYDL--HNDDLLR----RHVLPAGQLKQGSLLANLAVEDSDC 188
            ||:|....|..      .:.:|.|:||  :|.:|||    .|:   |......|...:..:...|
  Fly   110 WVMDIGFPGST------CSPRLFVFDLMRNNAELLRIDCGHHI---GANDTHFLTVQMGPKSPGC 165

  Fly   189 ENTFAYAADLGS-PGLVVYSWKDEESW-RVQHHFFHPDPMAGNFSINGIEFQWDDGLYG-LALSK 250
            |:.......||. |.::.|... |::| |:.......:.|..:|.|..::|.:  |:.| |.||.
  Fly   166 EHERHIYFILGKVPEILAYDIL-EQTWHRLSLESNKYENMNQSFPIKPVDFIF--GIQGELILSD 227

  Fly   251 PLETGYATLYFHPLCSTTEFSVDTSILRNKTLATSPMIYREFKV--LGSRGPNTQAGAEFLDPDT 313
            .....|:|             ||...:..|:...|..|....|:  |||...::::   .:..:.
  Fly   228 QDGDLYST-------------VDRLEIEGKSELASKPINNSIKLTHLGSLLGSSRS---MIIDNF 276

  Fly   314 GVLFYALPNLNEVACWRTATDFSHSSQSRIHMNNDTLVFPSDIKVDDQKRLWVLSNQL 371
            |.|:|.:|....|.......:.:......|::.:..:   ..|.......|||||:::
  Fly   277 GTLYYVIPKFGAVVRCAKLANITAEGNEIIYITSKNI---QQIFFTSNDALWVLSDRV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 60/268 (22%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.