DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-g2

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster


Alignment Length:413 Identity:99/413 - (23%)
Similarity:168/413 - (40%) Gaps:71/413 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRFRLGLLL----------------LWAVSALANDNLRVAYEWREMDFKYANPDQRWSAIERGEF 50
            :|..|.|:|                ||......:|:..:.:...:.:|..|:....:.:  .|:|
  Fly     1 MRLHLALILGFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPCASTKSLFKS--SGKF 63

  Fly    51 KPANVIPFGLEVAGHRLFVTLPRWRDGVPASLAYLDLNDTSSK----GPALKPFPSWQAHNLQEA 111
            .|.|||....::.|..:::.|||:|.||||:|.     .||.|    ....||:|.|   :|||.
  Fly    64 IPKNVIATRAQLIGDTIYLALPRYRKGVPATLV-----KTSIKPGTCSTTFKPYPCW---DLQEE 120

  Fly   112 E--PELVSPFRVRADRCGRLWVLDSRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVLPAGQLKQ 174
            .  ..|.|...:..|:...|||||:.|...||........:::...:....:|:. |...|....
  Fly   121 GNCKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKT-VSLEGLTSS 184

  Fly   175 GSLLANLAVE---DSDCENTFAYAADLGSPGLVVYSWKDEESWRVQHHFFHPDPM-AGNFSINGI 235
            .|.|..|.|:   |..|   |.|.:|..:..::||:.:.:..:||    ..|..: ||..|    
  Fly   185 NSRLQYLVVDYAPDGGC---FVYVSDAANRAIIVYNLQADRGFRV----VLPKAVTAGCRS---- 238

  Fly   236 EFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEFSVDTSILRNKTLATSPMIYREFKVLG-SRG 299
                .|.|| :||.: .:.|...|||..|.:...||:.:..||:..        .:.::|. .:.
  Fly   239 ----RDVLY-IALIR-RDCGSTELYFTYLSTNKLFSLKSEYLRSGV--------ADGRILDLGKK 289

  Fly   300 PNTQAGAEFLDPDTG-VLFYALPNLNEVACWRTATDFSHSSQSRIHMNNDTLVFPSDIKVDDQKR 363
            |:...   .:..|.| .:|:......||..|.|.:.|..::...::.:....:...  .|.|.||
  Fly   290 PSRMV---IIGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFKPVYRSQTCQLVTH--AVPDYKR 349

  Fly   364 --LWVLSNQLPVFIYDELYAGSI 384
              :.||.:..|.::.:.:..|:|
  Fly   350 NTMRVLQSNFPDYMQNRVGCGAI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 63/277 (23%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 63/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.