DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-d

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster


Alignment Length:427 Identity:128/427 - (29%)
Similarity:196/427 - (45%) Gaps:73/427 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EWREMDFKYANPDQRWSAIERGEFKPANVIPFGLE----VAGH-RLFVTLPRWRDGVPASLAYLD 86
            :|.:::|.:.....|.:|...|...|.|..|..::    ..|. |||.|:||:..|:|.:||.:.
  Fly    39 QWGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVTGIPYTLATVS 103

  Fly    87 LNDTSSKGPALKPFPSWQAHNLQ-EAEPELVSPFRVRADRCGRLWVLDSRISGVLEQTKIYGAAQ 150
            ... ...||.|:|:|::..||.. |....:.|.|||....|.::||:|   |||:..|::. ..|
  Fly   104 ATQ-GRNGPLLQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVID---SGVIGTTQLC-PPQ 163

  Fly   151 LLVYDLHNDDLLRRH------VLPAGQLKQGSLLANLAVED----SDCENTFAYAADLGSPGLVV 205
            ||.:.|..|.||.|.      .:|:|.|   .:..|:.|:|    ..|..|..|.||:...||||
  Fly   164 LLQFALATDRLLHRFRFPNDTYIPSGSL---FITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVV 225

  Fly   206 YSWKDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEF 270
            |..:.:.|||.::.|.:|||..|..:|.|..|...||::.|...|      ..||||||.|.:|:
  Fly   226 YDHQAQTSWRAENRFMYPDPDYGKHTIAGESFYLMDGMFALNNDK------RNLYFHPLASASEY 284

  Fly   271 SVDTSIL-RNKTLATSP-MIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVAC----- 328
            ||..|.| |.:..|..| .:..||::||.|.....|.             |:...|.|.|     
  Fly   285 SVPLSALNRQQNWANGPEALPEEFRLLGRRRSECAAS-------------AIDGRNNVYCVTFNP 336

  Fly   329 -----WRTATDFSHSSQSRIHMNNDTLVFPSDIKV----DDQKRLWVLSNQLPVFIYDELYAGS- 383
                 |...:.::..:...:...:|.|.|.|.:||    :.|:.||:|||:     |.::.||: 
  Fly   337 VKLFVWNVNSPYNSRNFGNLPAKSDDLQFVSGMKVLRNREGQEELWMLSNR-----YQKIAAGTL 396

  Fly   384 ----INFRILTASVKEAIENTACEIRTSPLPDVINKL 416
                :|||||    :..:::....:..|...|:.|:|
  Fly   397 NSKEVNFRIL----RRKLDDVQGGVFFSNDEDLTNRL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 97/316 (31%)
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 97/314 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.