DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and y

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster


Alignment Length:399 Identity:148/399 - (37%)
Similarity:237/399 - (59%) Gaps:11/399 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WAVSALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWRD 76
            ||..     .|:..|.|.::||.:.|...:..|:..|::.|.|.:|.|:|..|:|||||:|||||
  Fly    20 WAAY-----KLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRD 79

  Fly    77 GVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADRCGRLWVLDSRISGVLE 141
            |:||:|.|::::.:.:..|.|.|:|.|:::...:....:.:.:|::.|.||||||||:...|:..
  Fly    80 GIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGN 144

  Fly   142 QTKIYGAAQLLVYDLHNDDLLRRHVLPAGQLKQGSLLANLAVE-DSDCENTFAYAADLGSPGLVV 205
            .|.......:.|:||..|..:||:.||.......:.:||:||: ..:|::.:||.||....||:.
  Fly   145 TTTNPCPYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFADELGYGLIA 209

  Fly   206 YSWKDEESWRVQ-HHFFHPDPMAGNFSINGIEFQW-DDGLYGLALSKPLETGYATLYFHPLCSTT 268
            |||:..:|||.. |.:|.|||:.|:|::.||.||| ::|::|::||.....||.||||.||.|..
  Fly   210 YSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLASHR 274

  Fly   269 EFSVDTSILRNKTLATSPMIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVACWRTAT 333
            :|:|.|.|||::|.....  |.:|..|..||||:...:..:. |.|:..:.|.:.|.|.||.::.
  Fly   275 QFAVSTRILRDETRTEDS--YHDFVALDERGPNSHTTSRVMS-DDGIELFNLIDQNAVGCWHSSM 336

  Fly   334 DFSHSSQSRIHMNNDTLVFPSDIKVDDQKRLWVLSNQLPVFIYDELYAGSINFRILTASVKEAIE 398
            .:|......:..::..||||:|:|:|:.|.:||||:::|||:..:|.....||||.||.:...||
  Fly   337 PYSPQFHGIVDRDDVGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLIE 401

  Fly   399 NTACEIRTS 407
            ||.|::|.:
  Fly   402 NTVCDLRNN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 110/288 (38%)
yNP_476792.1 MRJP 119..405 CDD:308585 110/288 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23419at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.