DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and Rgn

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_113734.1 Gene:Rgn / 25106 RGDID:3560 Length:299 Species:Rattus norvegicus


Alignment Length:177 Identity:33/177 - (18%)
Similarity:58/177 - (32%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ANVIPFGLEVAGHRLFVTLPRWRDGVPASLAY-LDLNDTSSKGPALKPFPSWQAHN---LQEAEP 113
            :|.:.:.|:   |::|..:.        ||:| :|..|..        .|:.|..|   :.:.|.
  Rat   153 SNGLDWSLD---HKIFYYID--------SLSYTVDAFDYD--------LPTGQISNRRTVYKMEK 198

  Fly   114 ELVSPFRVRADRCGRLWVLDSRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVLPAGQ------- 171
            :...|..:..|..|:|||            ..|...:::..|......|:...||..:       
  Rat   199 DEQIPDGMCIDVEGKLWV------------ACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFG 251

  Fly   172 ----------LKQGSLLANLAVEDSDCENTFAYAADLGSPGLVVYSW 208
                      ..:..:.|...:...|..|.|.... ||..|:..||:
  Rat   252 GKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITG-LGVKGIAPYSY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 20/110 (18%)
RgnNP_113734.1 SGL 16..264 CDD:285626 24/141 (17%)
NHL 166..>237 CDD:302697 18/98 (18%)
WD40 repeat 203..239 CDD:293791 9/47 (19%)
NHL repeat 203..237 CDD:271320 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.