DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BuGZ and ZNF207

DIOPT Version :9

Sequence 1:NP_001260513.1 Gene:BuGZ / 35004 FlyBaseID:FBgn0032600 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001091977.1 Gene:ZNF207 / 7756 HGNCID:12998 Length:494 Species:Homo sapiens


Alignment Length:466 Identity:171/466 - (36%)
Similarity:212/466 - (45%) Gaps:177/466 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKKKASKPWCWYCNREFDDEKILVQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKETVDKV 65
            |||||||..|||||||||:|||||||:|||||||||||||||||||||||:||||||||||:|.|
Human     1 MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAV 65

  Fly    66 PNSLPNRSNIEVEIFGMDGIPAEDL---------RDHERQKNGGKSDS---DDDEPVAKKK---- 114
            ||::|.|::||:||:||:|||.:|:         :..|.||...:.||   |||:..|...    
Human    66 PNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQ 130

  Fly   115 -------------------VEYAMSVP----------PPMM--MPPNM--MPP---H-------- 135
                               |..|..:|          ||:|  |||.|  |||   |        
Human   131 PVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSF 195

  Fly   136 -----MLGQYGM------------GMMQHMPP-----------------------LPPYPVPMMP 160
                 |:...||            ||...|||                       .||.|...:|
Human   196 CGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVP 260

  Fly   161 HMMPP--RPLFPAA--MAT--TSAAAAAAAAHHHHAA--------AMAQ---------------- 195
            ...||  :||||:|  |.|  ||::.|::.:....|:        |.||                
Human   261 APQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNS 325

  Fly   196 --------QKPTFPAYSNATISAPPTTNHAGGASSAPPSGPPDAQQHQQRPPAPPAASGTSAAA- 251
                    .|||||||:.:|.|...|||     |:|                |.||||.||..| 
Human   326 TPATTTEPPKPTFPAYTQSTASTTSTTN-----STA----------------AKPAASITSKPAT 369

  Fly   252 -----VTTKIMHPQEDLSLEELRARQPKIQARLAAALASLANPQSRKSPSNNG--GP-STSIPTT 308
                 .|:|::||.||:||||.||:.||.|..|         |:..::|..|.  || ...:|..
Human   370 LTTTSATSKLIHPDEDISLEERRAQLPKYQRNL---------PRPGQAPIGNPPVGPIGGMMPPQ 425

  Fly   309 PPPPSLAGISP 319
            |..|...|:.|
Human   426 PGIPQQQGMRP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BuGZNP_001260513.1 C2H2 Zn finger 13..32 CDD:275368 16/18 (89%)
C2H2 Zn finger 37..58 CDD:275368 19/20 (95%)
PABP-1234 <479..607 CDD:130689
ZNF207NP_001091977.1 SUF4-like 10..90 CDD:411020 64/79 (81%)
C2H2 Zn finger 13..34 CDD:411020 18/20 (90%)
C2H2 Zn finger 13..32 CDD:275368 16/18 (89%)
C2H2 Zn finger 37..58 CDD:411020 19/20 (95%)
C2H2 Zn finger 37..58 CDD:275368 19/20 (95%)
SMN <436..471 CDD:399180 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 224 1.000 Domainoid score I2563
eggNOG 1 0.900 - - E1_KOG2893
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3512
Isobase 1 0.950 - 0 Normalized mean entropy S2710
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004631
OrthoInspector 1 1.000 - - oto89916
orthoMCL 1 0.900 - - OOG6_102795
Panther 1 1.100 - - LDO PTHR23215
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4116
SonicParanoid 1 1.000 - - X3245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.