DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BuGZ and znf-207

DIOPT Version :9

Sequence 1:NP_001260513.1 Gene:BuGZ / 35004 FlyBaseID:FBgn0032600 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_502124.1 Gene:znf-207 / 178042 WormBaseID:WBGene00007105 Length:341 Species:Caenorhabditis elegans


Alignment Length:340 Identity:131/340 - (38%)
Similarity:159/340 - (46%) Gaps:79/340 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRKKKKASKPWCWYCNREFDDEKILVQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKETVDKV 65
            |||||||..|||||||||||||||||:|||||||||||||||||::|||||||||||||||:||:
 Worm     1 MGRKKKKVDKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHKETIDKI 65

  Fly    66 PNSLPNRSNIEVEIFGMDGIPAEDLRDHERQKNGGKSDSDDDEPVAKKKVEYAMSVPPPMMMPPN 130
            |.::..|.||.|||:||.|||:...|        |.:|.:.||  .:.:::....:|.||..|.:
 Worm    66 PAAVHGRDNIHVEIYGMQGIPSGAYR--------GAADEEPDE--KRSRMDNGPPMPTPMPFPQH 120

  Fly   131 M----MPPHMLG------QYGM-----GMM-------QHMPP--LPPYPVP---MMPHMMP---P 165
            .    |||...|      .|||     |||       .:.||  .||.|.|   |.|..||   |
 Worm   121 FPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVYMPPPGMPGAYP 185

  Fly   166 RPLFPAAMATTSAAAAAAAAHHHHA---------AAMAQQKPTFPAYSN----ATISAPPTTNHA 217
            .|..|....................         ....:..|..|.|.|    ....||...|..
 Worm   186 PPRMPIGHGPPGGPPMPGPPQRSRFDQPDGGDRWGPPMRGVPRTPPYENEHEHQDYQAPDDYNQG 250

  Fly   218 G-------GASSAPPSG----------PPDAQQHQQRPPAPPA-ASGTSAAAVT-------TKIM 257
            |       |....||.|          ..:..:....||...: |:..|||||.       |:|:
 Worm   251 GYDDRFREGDRGGPPGGSRFDQVKAELKEEIVEPNNGPPTTSSGAAAASAAAVVASKLGSRTRIV 315

  Fly   258 HPQE-DLSLEELRAR 271
            :|.: .|||||.|.:
 Worm   316 YPDDHSLSLEERRVK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BuGZNP_001260513.1 C2H2 Zn finger 13..32 CDD:275368 17/18 (94%)
C2H2 Zn finger 37..58 CDD:275368 18/20 (90%)
PABP-1234 <479..607 CDD:130689
znf-207NP_502124.1 C2H2 Zn finger 13..32 CDD:275368 17/18 (94%)
C2H2 Zn finger 37..58 CDD:275368 18/20 (90%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2710
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004631
OrthoInspector 1 1.000 - - oto20472
orthoMCL 1 0.900 - - OOG6_102795
Panther 1 1.100 - - LDO PTHR23215
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4116
SonicParanoid 1 1.000 - - X3245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.