DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and LSM1A

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_564072.1 Gene:LSM1A / 838495 AraportID:AT1G19120 Length:128 Species:Arabidopsis thaliana


Alignment Length:71 Identity:23/71 - (32%)
Similarity:36/71 - (50%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRG 88
            |:.||:|::.|....||:..|:|:.:|...|.||:...|.:...|....:      .|||.:.||
plant    15 LAAYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYERVIVGDLYCDI------PLGLYIIRG 73

  Fly    89 TALVLI 94
            ..:|||
plant    74 ENVVLI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 23/71 (32%)
LSM1ANP_564072.1 LSm1 9..82 CDD:212475 23/71 (32%)

Return to query results.
Submit another query.