DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and AT4G30330

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_567844.1 Gene:AT4G30330 / 829156 AraportID:AT4G30330 Length:88 Species:Arabidopsis thaliana


Alignment Length:66 Identity:15/66 - (22%)
Similarity:31/66 - (46%) Gaps:16/66 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVL 93
            :|.:|::        |.:.|:|..:|||||..        |...:.::..:.||.::.:|..:.|
plant    34 QKDLRIE--------GRITGFDEYMNLVLDEA--------EEVSIKKKTRKPLGRILLKGDNITL 82

  Fly    94 I 94
            :
plant    83 M 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 15/66 (23%)
AT4G30330NP_567844.1 Sm_E 7..85 CDD:212465 15/66 (23%)

Return to query results.
Submit another query.