DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and LSM1B

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_566476.1 Gene:LSM1B / 820624 AraportID:AT3G14080 Length:128 Species:Arabidopsis thaliana


Alignment Length:73 Identity:24/73 - (32%)
Similarity:36/73 - (49%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQ--TRSLGLVVC 86
            |:.||::::.|....||:..|.|:.:|...|.||:...|.:        :..||  ...|||.|.
plant    15 LASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACERV--------IVGEQYCDIPLGLYVI 71

  Fly    87 RGTALVLI 94
            ||..:|||
plant    72 RGENVVLI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 24/73 (33%)
LSM1BNP_566476.1 LSm1 12..82 CDD:212475 24/73 (33%)

Return to query results.
Submit another query.