DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and LSM6B

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_181909.1 Gene:LSM6B / 818985 AraportID:AT2G43810 Length:91 Species:Arabidopsis thaliana


Alignment Length:73 Identity:18/73 - (24%)
Similarity:29/73 - (39%) Gaps:9/73 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLI 94
            |.:.||...|.:..|||...|..:|:.::.|.||:..         :...:.|....||..::.|
plant    25 KPVVVKLNSGVDYRGILTCLDGYMNIAMEQTEEYVNG---------QLKNTYGDAFVRGNNVLYI 80

  Fly    95 CPQDGVES 102
            ....|..|
plant    81 STTKGTLS 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 18/73 (25%)
LSM6BNP_181909.1 LSm6 14..81 CDD:212473 15/64 (23%)

Return to query results.
Submit another query.