DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and Snrpgl1

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001396106.1 Gene:Snrpgl1 / 687679 RGDID:1583028 Length:76 Species:Rattus norvegicus


Alignment Length:72 Identity:25/72 - (34%)
Similarity:44/72 - (61%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCR 87
            :|.|:::|::.:|..|||...|||:|:|..:|||:|..||         ..|..|..::|:||.|
  Rat     8 ELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVE---------MATSGQQNNIGMVVIR 63

  Fly    88 GTALVLI 94
            |.:::::
  Rat    64 GNSIIML 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 25/72 (35%)
Snrpgl1NP_001396106.1 Sm_G 5..74 CDD:212466 25/72 (35%)

Return to query results.
Submit another query.