powered by:
Protein Alignment LSm7 and SNRPG
DIOPT Version :9
Sequence 1: | NP_001246045.1 |
Gene: | LSm7 / 35003 |
FlyBaseID: | FBgn0261068 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001304094.1 |
Gene: | SNRPG / 6637 |
HGNCID: | 11163 |
Length: | 96 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 22/62 - (35%) |
Similarity: | 36/62 - (58%) |
Gaps: | 9/62 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 DLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLV 84
:|.|:::|::.:|..|||...|||:|:|..:|||:|..|| ..|..|..::|:|
Human 8 ELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVE---------MATSGQQNNIGMV 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
LSm7 | NP_001246045.1 |
LSm7 |
18..107 |
CDD:212476 |
22/62 (35%) |
SNRPG | NP_001304094.1 |
Sm_G |
5..>60 |
CDD:212466 |
21/60 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593201at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.