DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and CG6610

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_648022.1 Gene:CG6610 / 38693 FlyBaseID:FBgn0035675 Length:91 Species:Drosophila melanogaster


Alignment Length:73 Identity:16/73 - (21%)
Similarity:37/73 - (50%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRG 88
            :.|.:..:|.:.....:|..|.|.|:|..:|::||:..|| .::.:..::|:     |..::..|
  Fly    19 VDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEY-ENTPDGRRITK-----LDQILLNG 77

  Fly    89 TALVLICP 96
            ..:.::.|
  Fly    78 NNITMLVP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 16/73 (22%)
CG6610NP_648022.1 LSm5 12..87 CDD:212479 16/73 (22%)

Return to query results.
Submit another query.