DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and CG2021

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:35/73 - (47%) Gaps:9/73 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTE--EQTRSLGLVVC 86
            |..|:...:.:..|.||...|.|||:|..:|:::|...|.:      :..|.  ||. .|||.:.
  Fly     4 LESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERV------FSTTSGIEQI-VLGLHII 61

  Fly    87 RGTALVLI 94
            ||..:.:|
  Fly    62 RGDNIAVI 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 22/73 (30%)
CG2021NP_647660.1 LSm8 1..91 CDD:212474 22/73 (30%)

Return to query results.
Submit another query.