DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and Lsm7

DIOPT Version :9

Sequence 1:NP_001246045.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_006241020.1 Gene:Lsm7 / 362829 RGDID:1305354 Length:109 Species:Rattus norvegicus


Alignment Length:98 Identity:74/98 - (75%)
Similarity:88/98 - (89%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQ 77
            |||::||||||||||::|.|||||.|||||||||||:|.|||||||.|:||:||.|:.|||||: 
  Rat    10 KEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTED- 73

  Fly    78 TRSLGLVVCRGTALVLICPQDGVESIANPFITQ 110
            ||.|||||||||::||||||||:|:|.|||:.|
  Rat    74 TRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_001246045.1 LSm7 18..107 CDD:212476 68/88 (77%)
Lsm7XP_006241020.1 LSm7 17..103 CDD:212476 66/86 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340776
Domainoid 1 1.000 118 1.000 Domainoid score I5728
eggNOG 1 0.900 - - E1_KOG1781
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6781
Inparanoid 1 1.050 154 1.000 Inparanoid score I4237
OMA 1 1.010 - - QHG54747
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0004040
OrthoInspector 1 1.000 - - oto98311
orthoMCL 1 0.900 - - OOG6_102418
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2785
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.