DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and lsm-7

DIOPT Version :9

Sequence 1:NP_001246045.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_502034.1 Gene:lsm-7 / 177988 WormBaseID:WBGene00003081 Length:104 Species:Caenorhabditis elegans


Alignment Length:96 Identity:57/96 - (59%)
Similarity:78/96 - (81%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KRRKESILDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTR 79
            ||:|||::||:::|:|:|||||.|||||||:|:|:|.|||:|||:..|||||...| .:..::||
 Worm     7 KRKKESVVDLTRFLDKEIRVKFQGGREASGVLRGFDQLLNMVLDDCREYLRDPQNP-SVVGDETR 70

  Fly    80 SLGLVVCRGTALVLICPQDGVESIANPFITQ 110
            .|||:|.||||:.::.|.||:|.|||||.||
 Worm    71 QLGLIVARGTAITVVSPADGLEQIANPFATQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_001246045.1 LSm7 18..107 CDD:212476 51/88 (58%)
lsm-7NP_502034.1 LSm7 10..98 CDD:212476 51/88 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159273
Domainoid 1 1.000 91 1.000 Domainoid score I4880
eggNOG 1 0.900 - - E1_KOG1781
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6781
Inparanoid 1 1.050 123 1.000 Inparanoid score I3302
Isobase 1 0.950 - 0 Normalized mean entropy S515
OMA 1 1.010 - - QHG54747
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0004040
OrthoInspector 1 1.000 - - oto18262
orthoMCL 1 0.900 - - OOG6_102418
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R670
SonicParanoid 1 1.000 - - X2785
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.