DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and lsm-1

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_496385.1 Gene:lsm-1 / 174700 WormBaseID:WBGene00003076 Length:125 Species:Caenorhabditis elegans


Alignment Length:91 Identity:24/91 - (26%)
Similarity:39/91 - (42%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVC 86
            :.|.:.|:|::.|....||:..|.|:..|...||:|::.||  |...|.|.....|    |.::.
 Worm    12 ISLFEQLDKKLLVVLRDGRKLIGFLRSIDQFANLILEDVVE--RTFVEKYFCETGQ----GFMLI 70

  Fly    87 RG--------------TALVLICPQD 98
            ||              |.|..:.|::
 Worm    71 RGENVELAGEIDDTIETGLTQVSPEE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 24/91 (26%)
lsm-1NP_496385.1 LSm1 8..81 CDD:212475 21/74 (28%)

Return to query results.
Submit another query.