DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and snr-7

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_491032.1 Gene:snr-7 / 171834 WormBaseID:WBGene00004920 Length:77 Species:Caenorhabditis elegans


Alignment Length:78 Identity:27/78 - (34%)
Similarity:49/78 - (62%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCR 87
            :|.||::|::.:|..|.|..||||:|:|..:|:|:|..|||.:|..         :.:||:.|.|
 Worm     8 ELKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGG---------SVNLGMTVIR 63

  Fly    88 GTALVLICPQDGV 100
            |.::|::.|::.:
 Worm    64 GNSVVIMEPKERI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 27/78 (35%)
snr-7NP_491032.1 Sm_G 5..74 CDD:212466 27/74 (36%)

Return to query results.
Submit another query.