DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and LSm1

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_321407.3 Gene:LSm1 / 1281490 VectorBaseID:AGAMI1_003627 Length:134 Species:Anopheles gambiae


Alignment Length:67 Identity:20/67 - (29%)
Similarity:33/67 - (49%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALV 92
            ::|::.|....||...|.|:..|...||||..|:|.:...:|...:..      |:|:.||..:|
Mosquito    15 VDKKLMVLLHDGRTLIGYLRSVDQFANLVLHRTIERIHVGNEYGDIQR------GVVIIRGENVV 73

  Fly    93 LI 94
            |:
Mosquito    74 LL 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 20/67 (30%)
LSm1XP_321407.3 LSm1 5..78 CDD:212475 20/67 (30%)

Return to query results.
Submit another query.