DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and SNRPG

DIOPT Version :10

Sequence 1:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_312222.2 Gene:SNRPG / 1273262 VectorBaseID:AGAMI1_001571 Length:76 Species:Anopheles gambiae


Alignment Length:73 Identity:26/73 - (35%)
Similarity:48/73 - (65%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTR-SLGLVVC 86
            :|.||::|::.:|..|||..||||:|:|..:|:|:|.::|..:|.          || ::|:||.
Mosquito     8 ELKKYMDKRLSLKLNGGRVVSGILRGFDPFMNVVVDESIEECKDG----------TRNNIGMVVI 62

  Fly    87 RGTALVLI 94
            ||.:::::
Mosquito    63 RGNSIIMV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_609807.1 LSm7 18..107 CDD:212476 26/73 (36%)
SNRPGXP_312222.2 Sm_G 5..74 CDD:212466 26/73 (36%)

Return to query results.
Submit another query.