DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm7 and lsm7

DIOPT Version :9

Sequence 1:NP_001246045.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_017951866.1 Gene:lsm7 / 100127774 XenbaseID:XB-GENE-1008123 Length:125 Species:Xenopus tropicalis


Alignment Length:98 Identity:73/98 - (74%)
Similarity:88/98 - (89%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQ 77
            |||::||||||||||::|.|||||.|||||||:|||:|.|||||||.|:||:||.|:.|||||: 
 Frog    26 KEKKKKESILDLSKYIDKAIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTED- 89

  Fly    78 TRSLGLVVCRGTALVLICPQDGVESIANPFITQ 110
            ||.|||||||||::||||||||:|:|.|||:.|
 Frog    90 TRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQ 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm7NP_001246045.1 LSm7 18..107 CDD:212476 67/88 (76%)
lsm7XP_017951866.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5788
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6781
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0004040
OrthoInspector 1 1.000 - - oto105005
Panther 1 1.100 - - LDO PTHR10553
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.110

Return to query results.
Submit another query.