DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ChLD3 and Cda5

DIOPT Version :9

Sequence 1:NP_609806.1 Gene:ChLD3 / 35002 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_722590.2 Gene:Cda5 / 33158 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster


Alignment Length:364 Identity:159/364 - (43%)
Similarity:221/364 - (60%) Gaps:24/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 AGACDPRKCHLPQCFCSKDGTQIPGSLPAQSVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPN 275
            |..|....|.||.|:|.  |..|||.||.:|:||::||||||::|..|.:|::. ||.:.|.|||
  Fly  1634 AAKCRKDVCLLPDCYCG--GRDIPGELPVESIPQIVLLTFDDSVNDLNKQLYTD-LFEKGRVNPN 1695

  Fly   276 GCPIKGTFYVSHPFTNYQYVQKLWNDGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIIN 340
            ||||..||||||.:|:|..||.|:.||||:|.|:|:|...|.:..|.     |..|:.||..|:.
  Fly  1696 GCPITATFYVSHEWTDYSQVQNLYADGHEMASHTVSHSFGEQFSQKK-----WTREIAGQREILA 1755

  Fly   341 KFAAVRMEEIRGMRVPFLRVGWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGV 405
            .:..|:|.::||||.|||.||.|:.:.|:.:..|.|||||....:.||.||||||||:.|.|  :
  Fly  1756 AYGGVKMSDVRGMRAPFLSVGGNKMYKMLYDSNFTYDSSMPVYENRPPSWPYTLDYKIFHDC--M 1818

  Fly   406 NQNCPSRSYPGIWELVM---NQLEVGEYMCGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFG 467
            ...||:|||||:|::.|   ..|..|.  |.|.|.|......:.|.:|:..||:|||.:||||||
  Fly  1819 IPPCPTRSYPGVWQVPMVMWQDLNGGR--CSMGDACSNPSDADGVTKMIMKNFERHYTTNRAPFG 1881

  Fly   468 LYFHSTWFKKVDYLNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLD 532
            |::|:.||.:..:...|:||||.:..:.||:.:||.||:||:|.|||.::::.|:.:.|   |..
  Fly  1882 LFYHAAWFTQPHHKEGFIKFLDAINAMQDVWIITNWQALQWVRDPTPISRINSFQPFQC---DYS 1943

  Fly   533 PHEQVCNTPNVCKV--RSRVLQEDRFFYTCMECPAQYPW 569
            ...:.||.|.||.:  :|.|    |:..||..||..|||
  Fly  1944 DRPKRCNNPKVCNLWHKSGV----RYMKTCQPCPDIYPW 1978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884
LDLa 168..202 CDD:238060
CE4_CDA_like_1 243..512 CDD:200596 124/271 (46%)
Cda5NP_722590.2 CBM_14 58..106 CDD:279884
CE4_CDA_like_2 1664..1926 CDD:200597 124/271 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I4700
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060206at2759
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 1 1.000 - - otm14253
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.