DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ChLD3 and Cda4

DIOPT Version :9

Sequence 1:NP_609806.1 Gene:ChLD3 / 35002 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:473 Identity:170/473 - (35%)
Similarity:251/473 - (53%) Gaps:61/473 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CAKYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGC 175
            |.:::.|:||..:..:|..||.||.|::.|.||... .|.....||||.                
  Fly    43 CRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDEA-KCGPLPTTPAPA---------------- 90

  Fly   176 ADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLPAQ 240
                                        .|...:.|..|:...|.||.||||||||||||.|..:
  Fly    91 ----------------------------TEAPADTAQRCNTENCALPYCFCSKDGTQIPGDLEPE 127

  Fly   241 SVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWNDGHEI 305
            .:||:|:||||.|:|.:|::.:.|: |...|:|||||.|:|||::||.::|||.:|.|...||||
  Fly   128 KIPQIIMLTFDGAVNLNNYQHYQKI-FDGKRKNPNGCLIRGTFFMSHEYSNYQQIQHLGYYGHEI 191

  Fly   306 AVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNRQFLMMK 370
            ...|::    :....::...|:|..||:|...|:..||.|.:.::.|||.|||:.|.|.|:.:::
  Fly   192 GTESIS----QQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKVLE 252

  Fly   371 EFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWELVMNQLEVGEY---MC 432
            :||::||||:..|....|:||||||||:.|.|.  :..||||::||:||:.:|...|..|   .|
  Fly   253 DFGYIYDSSITVPPVPVPVWPYTLDYKISHECK--SGTCPSRTFPGVWEVPLNTHYVEGYEGGHC 315

  Fly   433 GMVDTCPPH-LSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDYLNAFLKFLDDLQKLPD 496
            ..:|.|..| |..|:|::.|..:|.|:|..|:||:.:.||:.||:.....|...||||...:|||
  Fly   316 PYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQTKPLENGLHKFLDWALELPD 380

  Fly   497 VFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNTPNVC----KVRSRVLQEDRFF 557
            |:.:|..|.:|::..|.....:.|.|||.|. |.:....:.||....|    |:..:.|.:.|:.
  Fly   381 VYILTVTQMLQYVTDPKELRDVSQIESWKCD-KSVSVAPKPCNIWQTCALPFKIPEQNLTDTRYM 444

  Fly   558 YTCMECPAQYPWIRNEFG 575
            .||.|||..|||:.:..|
  Fly   445 ETCRECPNVYPWLGDAGG 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 13/37 (35%)
LDLa 168..202 CDD:238060 0/33 (0%)
CE4_CDA_like_1 243..512 CDD:200596 111/272 (41%)
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 13/37 (35%)
CE4_CDA_like_1 130..396 CDD:200596 111/272 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060206at2759
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 1 1.000 - - otm14253
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4295
66.020

Return to query results.
Submit another query.