DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ChLD3 and F48E3.8

DIOPT Version :9

Sequence 1:NP_609806.1 Gene:ChLD3 / 35002 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001360756.1 Gene:F48E3.8 / 181010 WormBaseID:WBGene00018607 Length:2111 Species:Caenorhabditis elegans


Alignment Length:321 Identity:71/321 - (22%)
Similarity:108/321 - (33%) Gaps:116/321 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CPGENAYNANGQTGFTVKVVASAQRRSKP-----QPTARIPNAH--RLPSLCIWMMVALMIMSSS 60
            ||....|........||      |:..:|     |.:|..|.|:  ::...|::.|     ..||
 Worm    98 CPAGQTYIREAGVCMTV------QQPGEPCQYSQQCSALEPGAYCLKMRCECVYGM-----KKSS 151

  Fly    61 LDALVIDND----GIV---------------GNQTRHRRSTSGA---ASC-MQDARFYRN----- 97
            .....::||    |.:               |....|....|||   |:| ||......|     
 Worm   152 NGCTFVNNDCKERGHIFISEIGECREVFPPGGKGCSHNLQCSGAYPDATCFMQTCTCPPNLPVAA 216

  Fly    98 --------PNRPVHKIWT---------------NSECAKYF----------LCLDGEVFE-FKCS 128
                    ||..|:...|               :|:|...|          .|.:|.||: .|||
 Worm   217 DGTCGRSCPNNQVYSGVTGECLPEKQPGQDCIYSSQCQASFGGLVCDKNTCRCPNGLVFDGLKCS 281

  Fly   129 EGL-----LFDVVRQICDFKANVDNCDVSAETPAPKPLLEMAD-CADEYQLG--C-ADGTCLPQE 184
            .|.     :.|  ::||     |:.|        |..::|:|. |..:..:|  | |:..|....
 Worm   282 HGCPPHKRVID--KEIC-----VEGC--------PSGIVEVAGRCVKQVSIGQPCVANAQCNFGS 331

  Fly   185 YFCDGSVDCPDG---SDEGWCDVEHDPNAAGACDPRK-------CHLPQCFCSKDGTQIPG 235
            :...|:..||.|   .||....:|.:||.  :|...:       |:..:|.|.::...|.|
 Worm   332 FCQSGTCQCPPGFYVQDEQCQAIESEPNE--SCQNNEKCTKGSVCYNGKCSCPRNHELING 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 14/53 (26%)
LDLa 168..202 CDD:238060 10/39 (26%)
CE4_CDA_like_1 243..512 CDD:200596
F48E3.8NP_001360756.1 EB 98..154 CDD:366756 15/66 (23%)
EB 224..280 CDD:366756 11/55 (20%)
EB 300..351 CDD:366756 15/58 (26%)
EB 340..392 CDD:366756 14/53 (26%)
EB <438..476 CDD:366756
EB 514..563 CDD:366756
EB 552..607 CDD:366756
EB 596..650 CDD:366756
EB 639..692 CDD:366756
EB 681..734 CDD:366756
EB 723..776 CDD:366756
EB 808..860 CDD:366756
EB 961..1019 CDD:366756
EB <1111..1150 CDD:366756
EB 1283..1340 CDD:366756
EB 1413..1473 CDD:366756
EB 1462..1517 CDD:366756
EB 1757..1812 CDD:366756
EB <1893..1930 CDD:366756
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17034
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.