DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glu and EMC10

DIOPT Version :9

Sequence 1:NP_723996.1 Gene:glu / 35001 FlyBaseID:FBgn0015391 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster


Alignment Length:156 Identity:37/156 - (23%)
Similarity:63/156 - (40%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 TLNEELEK-QQAELTKTTAPLTEKRLKLSDELVGLKEKV---NTAKGEVQVFESQLKILKQAE-- 518
            :||..|.. :|.:|:.....|. |:|.|.:|...||..|   |.||.:........::| ||:  
  Fly    54 SLNSGLANVEQPDLSTADLDLL-KKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLL-QAQLN 116

  Fly   519 -----TTESRKYET-LKSSYEQSQKSLEEKVTRVDELKESIPRMKTEIASKSAEVD--------- 568
                 :.|...|.| :..|.:.:..::|.....|::|.|:  :..|::..:.||:.         
  Fly   117 DVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLLET--QFSTDVLIRHAELAPVPDTAGFI 179

  Fly   569 KMVKEERNLSMQCNKLRTEINERSSV 594
            :.|:.||           |..||..|
  Fly   180 QKVERER-----------EARERGEV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gluNP_723996.1 ABC_SMC4_euk 87..>246 CDD:213241
Smc 89..1281 CDD:224117 37/156 (24%)
SMC_hinge 618..733 CDD:214944
ATP-synt_B <825..904 CDD:304375
ABC_SMC4_euk <1196..1290 CDD:213241
EMC10NP_730662.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.