DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glu and C44C10.5

DIOPT Version :9

Sequence 1:NP_723996.1 Gene:glu / 35001 FlyBaseID:FBgn0015391 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_001359562.1 Gene:C44C10.5 / 183454 WormBaseID:WBGene00008086 Length:277 Species:Caenorhabditis elegans


Alignment Length:345 Identity:63/345 - (18%)
Similarity:116/345 - (33%) Gaps:103/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 KIEHHRREANSRINTPENVPRLYDLVKVEDDR-VRTAFYFALRNTLVCDDLEQGTRIAYGRERYR 741
            |:|.|              .::.:|::||..: :....|....|.|....||:            
 Worm     8 KVEKH--------------TKMKELIQVEQGQFISLHLYRLFLNDLERKSLEK------------ 46

  Fly   742 VVTLRGEMIEMTGTMSGGGSRPIRGKMGTQVRTKTAESADSSQISQKALEDMQIQAEELQARVNY 806
              .|..|.:::|...:...|:            |..:|.|...|::        ||.....:|..
 Worm    47 --KLTKEQVKLTNIKASKQSQ------------KVTKSDDPKAIAK--------QAPPAMFKVQG 89

  Fly   807 CQEQQGSLEREIQTLKNGLQRDEAEYKRLAVSITSLEQQMASNLKQCEAQRQRMLKKTTDERAVK 871
            |....|          :.|.::.||...:.:       ::.:.|.|..|||::::...|      
 Worm    90 CSRLDG----------DSLSQENAEKPAIVI-------ELENRLVQQRAQRRKIIANVT------ 131

  Fly   872 EREEQIEAAKQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQIEKLAANVRS 936
                        |:......:...:...:::..|.:|.:|        :||.::..|.:..::|:
 Worm   132 ------------LQDLDIPAKEAGTFSYDVKPDYSSLPDE--------LKKESNDAETVKMHLRT 176

  Fly   937 LNVGLATADRNITKITGNNNNLRENIKAAEEKLKSLNEDRNKAKEKKEELEKEIEESEAS----- 996
            |...:.........:.|.......||.....:..|.   .|.||.:..|||.|||:.:||     
 Worm   177 LEETIQATRNEWVAVNGAEYPDMSNILIRFHETDSF---INIAKLRTTELEAEIEQVKASRRTHF 238

  Fly   997 ---IEGAKSQSSDIKKEIDE 1013
               :....|..|.|.:||.|
 Worm   239 NQRLAAVSSSVSRIYREISE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gluNP_723996.1 ABC_SMC4_euk 87..>246 CDD:213241
Smc 89..1281 CDD:224117 63/345 (18%)
SMC_hinge 618..733 CDD:214944 11/55 (20%)
ATP-synt_B <825..904 CDD:304375 10/78 (13%)
ABC_SMC4_euk <1196..1290 CDD:213241
C44C10.5NP_001359562.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.