DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and INDH

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_193689.1 Gene:INDH / 827696 AraportID:AT4G19540 Length:313 Species:Arabidopsis thaliana


Alignment Length:241 Identity:89/241 - (36%)
Similarity:131/241 - (54%) Gaps:16/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGE 110
            |.:..:||:   :.:.|||||||||:....|...|| :..:...|:||.|:.|||.|.:|..  .
plant    37 LRLHGVKDI---IAVASGKGGVGKSSTAVNLAVALA-NKCELKIGLLDADVYGPSVPIMMNI--N 95

  Fly   111 SVHQSGYGWSPVGIED-NVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDT 174
            ...|.......:.:|: .|..||:| ||...|..::||||.....:.:....||||:||:|::|.
plant    96 QKPQVNQDMKMIPVENYGVKCMSMG-LLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDILVVDM 159

  Fly   175 PPGTSDEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFR 239
            ||||.|..:|:...||...      ||:|:|||:|:|.|..:.|:...|..:||:|::||||.|.
plant   160 PPGTGDAQISISQNLKLSG------AVIVSTPQDVALADANRGISMFDKVRVPILGLVENMSCFV 218

  Fly   240 CGHCGNSSEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSG 285
            |.||...|.||..:  ||....|:.|:.|:|.:||:..|.:..|.|
plant   219 CPHCNEPSFIFGKE--GARRTAAKKGLKLIGEIPLEMSIREGSDEG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 87/236 (37%)
ParA 54..307 CDD:287566 86/233 (37%)
INDHNP_193689.1 ParA 41..286 CDD:402307 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.