DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and HCF101

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_189086.1 Gene:HCF101 / 822033 AraportID:AT3G24430 Length:532 Species:Arabidopsis thaliana


Alignment Length:266 Identity:82/266 - (30%)
Similarity:126/266 - (47%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRL---------MGALG 109
            :.:.:.:.|.|||||||||...|...||  ...:..|:.|.|:.|||.|.:         |....
plant   175 ISNIIAVSSCKGGVGKSTVAVNLAYTLA--GMGARVGIFDADVYGPSLPTMVNPESRILEMNPEK 237

  Fly   110 ESVHQSGYGWSPVGIEDNVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDT 174
            :::..:.|    :|::    |:|.||   :.....|.|||..:|:|.|.|:..:||.||.|::|.
plant   238 KTIIPTEY----MGVK----LVSFGF---AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDM 291

  Fly   175 PPGTSDEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFR 239
            ||||.|..|::.......|      ||:|||||:::.:||.|.:....|..:|.|.|:|||    
plant   292 PPGTGDIQLTLCQVAPLTA------AVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM---- 346

  Fly   240 CGHCGNSSEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGEDLTEFKNVTTEALEGICS 304
            |....:....:|...|..:.:..:.|||.|..||:...:|.:.|||         |.|.:....|
plant   347 CHFDADGKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSG---------TPEVVSDPLS 402

  Fly   305 KIMASF 310
            .:..:|
plant   403 DVARTF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 75/236 (32%)
ParA 54..307 CDD:287566 81/261 (31%)
HCF101NP_189086.1 FeS_assembly_P 76..160 CDD:412662
ParA 174..411 CDD:402307 82/266 (31%)
DUF971 <448..515 CDD:412889
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.