DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and NUBPL

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_079428.2 Gene:NUBPL / 80224 HGNCID:20278 Length:319 Species:Homo sapiens


Alignment Length:314 Identity:99/314 - (31%)
Similarity:155/314 - (49%) Gaps:51/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVESMKD------------------VKHK 57
            ||.....|..:|..|.....:|   .::|...|.    |::|.                  ||..
Human    12 GVSLRAGGGATAPLGGSRAMVC---GRQLSGAGS----ETLKQRRTQIMSRGLPKQKPIEGVKQV 69

  Fly    58 LLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGE-SVHQS------ 115
            :::.||||||||||....|...||.::.....|:||:|:.|||.|::|...|. .:.||      
Human    70 IVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPL 134

  Fly   116 -GYGWSPVGIEDNVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTS 179
             .||         :..||:|||: ...:.::|||......|.:.|.:||||.||.|::|.||||.
Human   135 LNYG---------IACMSMGFLV-EESEPVVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGTG 189

  Fly   180 DEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCG 244
            |..|||      ..|.....||:|:|||:::|:|..|.....::.::|::|:::|||.|:|..|.
Human   190 DVQLSV------SQNIPITGAVIVSTPQDIALMDAHKGAEMFRRVHVPVLGLVQNMSVFQCPKCK 248

  Fly   245 NSSEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGEDLTEFKNVTTEA 298
            :.:.||.|  .||..:...:|:.:||.:||...|.:|.|:|:.:...:..:.||
Human   249 HKTHIFGA--DGARKLAQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 94/296 (32%)
ParA 54..307 CDD:287566 89/253 (35%)
NUBPLNP_079428.2 ParA 65..311 CDD:287566 89/254 (35%)
minD_arch 69..311 CDD:131024 87/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.