DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and Nubpl

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_084036.2 Gene:Nubpl / 76826 MGIID:1924076 Length:319 Species:Mus musculus


Alignment Length:286 Identity:95/286 - (33%)
Similarity:149/286 - (52%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PPEHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPG--KALVVESMKDVKHKLLILSGKGGV 67
            ||..|..:     |.|....|..::.| .....::...|  |...:|.:::|   :::.||||||
Mouse    24 PPRGCRAL-----GCGRQLLGAESEAL-KQRRTQIMSRGLPKQKPIEGVREV---IVVASGKGGV 79

  Fly    68 GKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYGWSPVGIEDNVCLMS 132
            ||||....|...||.::.....|:||:|:.|||.|::|...|...........|: :...:..||
Mouse    80 GKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMMNLRGNPELSPNNLMRPL-LNYGIACMS 143

  Fly   133 IGFLLGSVDDA--IIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANP 195
            :|||   |::.  ::|||......|.:.|.:||||.||.|::|.||||.|..|||      ..|.
Mouse   144 MGFL---VEETAPLVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGTGDVQLSV------SQNI 199

  Fly   196 ESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIFPAKTGGAAAM 260
            ....||:|:|||:::|:|..|.....:|.|:|::|:::|||.|:|..|.:.:.||.|  .||..:
Mouse   200 PISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQCPKCKHKTHIFGA--DGARKL 262

  Fly   261 CAEMGIPLLGSLPLDQQISKACDSGE 286
            ...:.:.:||.:||...|.:|.|.|:
Mouse   263 AQTLDLDVLGDVPLHLSIREASDMGQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 89/275 (32%)
ParA 54..307 CDD:287566 85/235 (36%)
NubplNP_084036.2 Mrp 17..284 CDD:223563 92/280 (33%)
ParA 65..311 CDD:287566 85/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.