DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and NUBP1

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_002475.2 Gene:NUBP1 / 4682 HGNCID:8041 Length:320 Species:Homo sapiens


Alignment Length:286 Identity:167/286 - (58%)
Similarity:209/286 - (73%) Gaps:14/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEHCPGVESEEAGKGSACSGCPNQGLCSD-----PNKKLEDPGKALVVESMKDVKHKLLILSGKG 65
            |..|||.:|.:||:|::|.|||||.||:.     |:..:|:     :.|.||.||||:|:|||||
Human     5 PHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEE-----IKEKMKTVKHKILVLSGKG 64

  Fly    66 GVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYGWSPVGIEDNVCL 130
            ||||||.::.|...|| .:.::...:|||||||||.|::||..||.|||||.|||||.:|||:.:
Human    65 GVGKSTFSAHLAHGLA-EDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGV 128

  Fly   131 MSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANP 195
            ||:||||.|.|||:|||||||||||:|||.:||||.:|.|::||||||||||||||.||   |..
Human   129 MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYL---ATA 190

  Fly   196 ESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIFPAKTGGAAAM 260
            ....||::||||||||.|||||||||:|..:||:||:||||.|.|..|...|:|||..||||..|
Human   191 HIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELM 255

  Fly   261 CAEMGIPLLGSLPLDQQISKACDSGE 286
            |.::.:||||.:|||..|.|.||.|:
Human   256 CQDLEVPLLGRVPLDPLIGKNCDKGQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 162/276 (59%)
ParA 54..307 CDD:287566 146/233 (63%)
NUBP1NP_002475.2 ParA 53..303 CDD:287566 146/233 (63%)
minD_arch 57..303 CDD:131024 142/229 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151439
Domainoid 1 1.000 300 1.000 Domainoid score I1427
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1857
Inparanoid 1 1.050 343 1.000 Inparanoid score I2339
Isobase 1 0.950 - 0 Normalized mean entropy S354
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 1 1.000 - - oto90460
orthoMCL 1 0.900 - - OOG6_100169
Panther 1 1.100 - - LDO PTHR23264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R796
SonicParanoid 1 1.000 - - X3047
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.