DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and CG4858

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster


Alignment Length:262 Identity:123/262 - (46%)
Similarity:168/262 - (64%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYG 118
            ||:.:::||||||||||||::.|:  ||........|:||||:||||.|.|:|..|..:.|...|
  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLS--LALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDG 67

  Fly   119 WSPVGIEDN--VCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDE 181
            |.||..:::  :.:|||||||.:.:|.:|||||||..||||||::|.|..||.|::|||||||||
  Fly    68 WVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDE 132

  Fly   182 HLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNS 246
            |::|:..||:..   ...|::|||||||:|.||||||.||||..|.|:|::||||.|.|.||.:.
  Fly   133 HITVMECLKEVG---CHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194

  Fly   247 SEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQI-------SKACDSGEDLTEFKNVTTEALEGICS 304
            :.||.:..|.:.|..|:  :|.||:||:|.::       :...|...|.|     |.|.|..|..
  Fly   195 TNIFSSNGGVSLATYAQ--VPHLGTLPIDPRVGILAGTTTSVLDELPDST-----TAEVLTHIVE 252

  Fly   305 KI 306
            |:
  Fly   253 KL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 115/236 (49%)
ParA 54..307 CDD:287566 123/262 (47%)
CG4858NP_649243.1 ParA 4..254 CDD:287566 122/260 (47%)
minD_arch 8..254 CDD:131024 120/257 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102225at6656
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 1 1.100 - - P PTHR23264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.