DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and CG3262

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster


Alignment Length:290 Identity:91/290 - (31%)
Similarity:132/290 - (45%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PGKALVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMG 106
            |.|..:: .::|:   :::.|||||||||||.......||:..  ...|:||.||.||:.|.||.
  Fly    30 PKKQPII-GVQDI---IVVASGKGGVGKSTVAVNFACSLAKLG--KRVGLLDGDIFGPTIPLLMN 88

  Fly   107 ALGESVHQSGYGWSPVGIED----------NVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSE 161
            ..||.|           :.|          ||..:|:| :|..|:.::|||||.....|::.|..
  Fly    89 VHGEPV-----------VNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKG 141

  Fly   162 VDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNI 226
            .|||.||:|::||||||.|.|||:..:.....      .::||||...::....|..:..:|.|:
  Fly   142 TDWGLLDVLVIDTPPGTGDVHLSLSQHAPITG------VILVTTPHTAAVQVTLKGASMYEKLNV 200

  Fly   227 PIVGVIENMSSFRCGHCGNSSEIF--------PAKTGGAAAMCAEMGIPLLGSLPLDQQISKACD 283
            ||.||:|||....|.:|....|.|        |.|               |.|||||.:|:.:.:
  Fly   201 PIFGVVENMKYTICQNCNQRLEFFKDSRISSLPRK---------------LISLPLDSRIADSNE 250

  Fly   284 SG--------------------EDLTEFKN 293
            ||                    |::|:..|
  Fly   251 SGVPVVIKYPDSKYSYLFTQLAEEITQILN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 86/257 (33%)
ParA 54..307 CDD:287566 88/278 (32%)
CG3262NP_001260688.1 ParA 37..275 CDD:287566 87/275 (32%)
minD_arch 41..281 CDD:131024 88/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455525
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.