DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and NUBP2

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_036357.1 Gene:NUBP2 / 10101 HGNCID:8042 Length:271 Species:Homo sapiens


Alignment Length:272 Identity:123/272 - (45%)
Similarity:180/272 - (66%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DPGKALVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLM 105
            :||      ::..|:|.:|:|||||||||||:::.|.  ||..:.....|:||:|:||||.||::
Human     6 EPG------NLAGVRHIILVLSGKGGVGKSTISTELA--LALRHAGKKVGILDVDLCGPSIPRML 62

  Fly   106 GALGESVHQSGYGWSPVGI--EDNVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLD 168
            ||.|.:|||...||:||.:  |.::.|||:||||...|:|::|||||||.:|:||:|:|.||.||
Human    63 GAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELD 127

  Fly   169 LLLLDTPPGTSDEHLSVVSYLKDDANP-ESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVI 232
            .|::||||||||||::.:..|:    | :.|.|::|||||.||:.|||:|:.||:|..:.::|::
Human   128 YLVVDTPPGTSDEHMATIEALR----PYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIV 188

  Fly   233 ENMSSFRCGHCGNSSEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGED-LTEFK-NVT 295
            ||||.|.|.||...:.:|  ..||...:....|:|.|||:|||..:.:..:.|.| :.||. :..
Human   189 ENMSGFTCPHCTECTSVF--SRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPA 251

  Fly   296 TEALEGICSKIM 307
            ..||..|..||:
Human   252 FAALTSIAQKIL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 114/243 (47%)
ParA 54..307 CDD:287566 120/257 (47%)
NUBP2NP_036357.1 ParA 13..262 CDD:313763 119/256 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.