DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACADS and CG3902

DIOPT Version :9

Sequence 1:NP_000008.1 Gene:ACADS / 35 HGNCID:90 Length:412 Species:Homo sapiens
Sequence 2:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster


Alignment Length:403 Identity:147/403 - (36%)
Similarity:240/403 - (59%) Gaps:8/403 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    15 RALCPRAWRQLHTIYQSVELP-------ETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVK 72
            |.|...|.:|...:..:..||       :..:|:.:|....|::::.|:..::|.||.|..:.||
  Fly    11 RMLANAARQQSAAMSSATGLPPPLTFLTDDEKMMKETVAKLAQEQIQPLVKKMDFEHKFDPSVVK 75

Human    73 KMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQ 137
            .:...||:.:::..||||:|.:::...:.:||:|:...:....:.::|:|....::|||:.|||.
  Fly    76 AVFENGLMGIEIDTELGGSGCNFMTNIVVVEELSKIDPAVAAFVDIHNTLVNSLMIKFGNAEQKA 140

Human   138 AWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTD 202
            .:: |..:.:..|.|||:|||.||||.:..|.|:.:|..:|:||:|.||:|:..|...::||:..
  Fly   141 KYL-PKLAQEYAGSFALTEPGAGSDAFSLKTVAKKDGSHYVINGSKMWISNSDVAGVFLIFANAK 204

Human   203 RALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQT 267
            .....:||:.|:|...||||.:.|.|||||||.|.|..|.|::.|:|:::|||..|.|:|.|...
  Fly   205 PEDGYRGITTFIVDRETPGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFGHGYKYAAGF 269

Human   268 LDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAA 332
            |:.||||||:|.:|:||...|..:.|...|..||..:...|.:|.::|.:|..:|:|||:|:.||
  Fly   270 LNEGRIGIAAQMVGLAQGTFDATIPYLLERKQFGDAIYNFQSMQHQIATVATEIEAARLMTYNAA 334

Human   333 MLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEI 397
            .|::...||.|||||||..|||.|...:.:.:..:||:|:..:.|.|::|||.:|..|||||:.:
  Fly   335 RLQEQGVPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTTNM 399

Human   398 QRLVIAGHLLRSY 410
            |...||..:.:.|
  Fly   400 QLSTIAKCIKKDY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACADSNP_000008.1 CaiA 33..412 CDD:224871 143/385 (37%)
SCAD_SBCAD 36..408 CDD:173847 140/371 (38%)
CG3902NP_649069.2 CaiA 37..414 CDD:224871 141/377 (37%)
SCAD_SBCAD 39..410 CDD:173847 140/371 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 1 1.000 - - FOG0000508
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.