DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACADS and Mcad

DIOPT Version :9

Sequence 1:NP_000008.1 Gene:ACADS / 35 HGNCID:90 Length:412 Species:Homo sapiens
Sequence 2:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster


Alignment Length:413 Identity:159/413 - (38%)
Similarity:237/413 - (57%) Gaps:13/413 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     4 ALLARASGPARRALC--PRAWRQLHTIY---QSVELPETHQMLLQTCRDFAEKELFPIAAQVDKE 63
            |.|.:.:.||.|.|.  .||:..:..:.   .|..|.|....|.:..|.|..:|:.|:|||.||.
  Fly     2 AFLNKLAAPALRQLVSQSRAYAAVSHVSPNGTSFALTEDQLQLQELARKFTREEIIPVAAQYDKS 66

Human    64 HLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNS-LYLGPI 127
            ..:|...:||...|||:...:|.::||..||.....::.||::.||  ||::.::..| |...|:
  Fly    67 GEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGC--TGIMTALEASGLGQTPV 129

Human   128 LKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA 192
            :..|:||||:.::........:..:.::|||.|||.....|.|..:||.||:||.|.||||...|
  Fly   130 ILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRAEKKGDEWVINGQKMWITNGGVA 194

Human   193 SAAVVFASTD---RALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSIL 254
            :...|.|.|:   :...:|..:.|:|...:||||.|:||..:|.|.|.|..:.|||.|:||:::|
  Fly   195 NWYFVLARTNPDPKCPPSKAFTGFIVERDSPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVL 259

Human   255 GEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMAL 319
            ...|.||||||.|.|..|..:|:.|:|:||..||.|:.||..|..||.|:...|.:||.|||||:
  Fly   260 IGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAI 324

Human   320 ALESARLLTWR-AAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYR 383
            .:|::| |.|| :|...|..:.....|::||..|::.|..|:..|:||.||.|:.:|.|.|:..|
  Fly   325 GVETSR-LAWRLSAWEIDQGRRNSYYASIAKCHAADMANKIASDAVQIFGGNGFNSEYPVEKLMR 388

Human   384 DARITEIYEGTSEIQRLVIAGHL 406
            ||:|.:||||||:||||:|:.::
  Fly   389 DAKIYQIYEGTSQIQRLIISRNM 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACADSNP_000008.1 CaiA 33..412 CDD:224871 150/379 (40%)
SCAD_SBCAD 36..408 CDD:173847 149/376 (40%)
McadNP_648149.1 CaiA 35..411 CDD:224871 150/378 (40%)
MCAD 37..414 CDD:173846 150/378 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.