DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PUP3

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:41/194 - (21%)
Similarity:74/194 - (38%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGIKGPDFVMLAAD-TTHARSIIVMKEDQNKIHKV--SDSLLISTVGESGDTEQFTEFISKNIA 65
            ::.:.|.|.|.:|.| ...::|:.|    .||..|:  ...:.:...|.:.|.....|.......
Yeast    12 VVAMTGKDCVAIACDLRLGSQSLGV----SNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTN 72

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAG-PELTFIDYLA---NALP 126
            |||::....:.|.........:|  |.|...||.|...|||.:..:| |.:...|.:.   .|..
Yeast    73 LYKLKEERAIEPETFTQLVSSSL--YERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKD 135

  Fly   127 VNYAGHGYGAIF--ASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGV 188
            ...:|.....:|  ..|:|:    ||:...:.::...:.:.....|..::.....|.::.||.|
Yeast   136 FIVSGTASDQLFGMCESLYE----PNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 41/194 (21%)
proteasome_beta_type_2 1..192 CDD:239727 41/194 (21%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 41/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.