DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PRE2

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:32/185 - (17%)
Similarity:74/185 - (40%) Gaps:2/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.|..:....:::|.|:.......|..:...|:.:::..||.:..|.:.|.:.:..::.....|:
Yeast    77 TTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLH 141

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132
            ::|....:|...::......:.:|  ......:...:.||....||.:.::|.....|..:....
Yeast   142 ELREKERISVAAASKILSNLVYQY--KGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCV 204

  Fly   133 GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDG 187
            |.|..||..:.|..:..:::..:|..:.|:.|.....|...:..:..:..|.:||
Yeast   205 GSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 32/185 (17%)
proteasome_beta_type_2 1..192 CDD:239727 32/185 (17%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 32/185 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.