DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PRE9

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:43/203 - (21%)
Similarity:80/203 - (39%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |.:||...|.::|||:.....:::.......|::|::|.:.::..|.:.|.|     |..|.|..
Yeast    34 TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAE-----ILINTARI 93

  Fly    68 KMRNGYDLSPRES--AHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLANA 124
            ..:| |..:..|.  .....:.|::..:..|      |:.|....||||...|.:|    |.:|.
Yeast    94 HAQN-YLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL----YTSNP 153

  Fly   125 LPVNYAGH-----GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVD 184
             ..||.|.     |.....|.::....:..::...:|.::..|.:::......:.......|.:.
Yeast   154 -SGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIR 217

  Fly   185 KDGVRDLE 192
            | |..|.|
Yeast   218 K-GANDGE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 43/203 (21%)
proteasome_beta_type_2 1..192 CDD:239727 42/201 (21%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.