Sequence 1: | NP_001260511.1 | Gene: | Prosbeta4 / 34999 | FlyBaseID: | FBgn0032596 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021324576.1 | Gene: | psmb7 / 64278 | ZFINID: | ZDB-GENE-001208-4 | Length: | 286 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 53/199 - (26%) |
---|---|---|---|
Similarity: | 92/199 - (46%) | Gaps: | 10/199 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
Fly 68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFM---FVAGYDPNAGPELTFIDYLANALPVNY 129
Fly 130 AGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPI 194
Fly 195 SAAS 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4 | NP_001260511.1 | PRE1 | 1..194 | CDD:223711 | 51/193 (26%) |
proteasome_beta_type_2 | 1..192 | CDD:239727 | 50/191 (26%) | ||
psmb7 | XP_021324576.1 | proteasome_beta_type_7 | 44..232 | CDD:239732 | 51/193 (26%) |
Pr_beta_C | 237..280 | CDD:315191 | 53/199 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |