DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PSMA7

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_002783.1 Gene:PSMA7 / 5688 HGNCID:9536 Length:248 Species:Homo sapiens


Alignment Length:225 Identity:49/225 - (21%)
Similarity:94/225 - (41%) Gaps:67/225 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQ--NKIHKVSDSLLISTVGESGD------------- 52
            |.:|::|.|.|:|..:   .:|:..:::::  .||..:.|::.::..|.:.|             
Human    31 TAVGVRGRDIVVLGVE---KKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQ 92

  Fly    53 TEQFT-------EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPN 110
            :.:.|       |:|::.||..|.|            :|:.|      .|.|:.:...:.|:|.:
Human    93 SHRLTVEDPVTVEYITRYIASLKQR------------YTQSN------GRRPFGISALIVGFDFD 139

  Fly   111 AGPEL-------TFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQ 168
            ..|.|       |:..:.|||:     |.|     |.|:.: :...|.|. ||.:.....|..:.
Human   140 GTPRLYQTDPSGTYHAWKANAI-----GRG-----AKSVRE-FLEKNYTD-EAIETDDLTIKLVI 192

  Fly   169 KRLVVNL----KNFTVAVVDKD-GVRDLEP 193
            |.|:..:    ||..:||:.:| .::.|.|
Human   193 KALLEVVQSGGKNIELAVMRRDQSLKILNP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 49/225 (22%)
proteasome_beta_type_2 1..192 CDD:239727 47/222 (21%)
PSMA7NP_002783.1 proteasome_alpha_type_7 3..211 CDD:239724 45/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.