DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and PSMA6

DIOPT Version :10

Sequence 1:NP_609804.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_002782.1 Gene:PSMA6 / 5687 HGNCID:9535 Length:246 Species:Homo sapiens


Alignment Length:128 Identity:24/128 - (18%)
Similarity:47/128 - (36%) Gaps:29/128 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKMRNG 72
            |.||.::.::..||             :.|:::::.....|.:.|:....:......|.:|.:.|
Human    55 KVPDKLLDSSTVTH-------------LFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYG 106

  Fly    73 YDLSPRESAHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLANALPVNY 129
            |::    ......|.:|:..:..|      |....|.:.|.|...||::...|      |..|
Human   107 YEI----PVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCD------PAGY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_609804.1 proteasome_beta_type_2 1..192 CDD:239727 24/128 (19%)
PSMA6NP_002782.1 proteasome_alpha_type_6 8..220 CDD:239723 24/128 (19%)

Return to query results.
Submit another query.