Sequence 1: | NP_001260511.1 | Gene: | Prosbeta4 / 34999 | FlyBaseID: | FBgn0032596 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002779.1 | Gene: | PSMA3 / 5684 | HGNCID: | 9532 | Length: | 255 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 50/202 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TLLGIKGPDFVMLAADTTHARSIIVMK---EDQNK-IHKVSDSLLISTVGESGDTEQFTEFISKN 63
Fly 64 IALYKMRNGYDLSPRESAHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLA 122
Fly 123 NALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDG 187
Fly 188 VRDLEPI 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta4 | NP_001260511.1 | PRE1 | 1..194 | CDD:223711 | 40/200 (20%) |
proteasome_beta_type_2 | 1..192 | CDD:239727 | 40/198 (20%) | ||
PSMA3 | NP_002779.1 | proteasome_alpha_type_3 | 5..217 | CDD:239720 | 41/202 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |