DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb2

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001011057.1 Gene:psmb2 / 496467 XenbaseID:XB-GENE-946101 Length:199 Species:Xenopus tropicalis


Alignment Length:199 Identity:112/199 - (56%)
Similarity:151/199 - (75%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIA 65
            ||.|:||:|.|||::||||..|.|||.||.|.:|:.|:|:.:|:..|||:|||.||.|:|.||:.
 Frog     1 MEYLIGIQGNDFVLVAADTVCANSIIKMKHDVDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYA 130
            ||||||||:|||..:|:|||:|||:||||||||.|.:.:||||.:.||.|.::||||......:|
 Frog    66 LYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHDGPSLYYMDYLAALAKTRFA 130

  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPIS 195
            .|||||....||.|||:.|::|:.:|.::.||||||:|||.:::|.:|||.|:||||:.|||.|.
 Frog   131 AHGYGAYLTLSILDRYYKPDLTREDAVELLKKCIAELQKRFILSLPSFTVRVIDKDGIHDLETIP 195

  Fly   196 AASL 199
            |:.|
 Frog   196 ASGL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 109/192 (57%)
proteasome_beta_type_2 1..192 CDD:239727 107/190 (56%)
psmb2NP_001011057.1 proteasome_beta_type_2 1..192 CDD:239727 107/190 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2721
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2088
Inparanoid 1 1.050 236 1.000 Inparanoid score I3302
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm48058
Panther 1 1.100 - - LDO PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.