DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:198 Identity:34/198 - (17%)
Similarity:77/198 - (38%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |::.::....|::.||:..:....|.....:|:.:::|.:.....|.:.||:...:.::.::..:
  Fly    17 TIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSLNYH 81

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132
            :.:...|....|:|...|.....|   |......:.|||:|...|.::..|.........:....
  Fly    82 ENQTNKDALVFEAASEFRNYCYSY---RESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIG 143

  Fly   133 GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRL------------VVNLKNFTVAVVDK 185
            |.|:.|.......::.||:       ..:.|:..::|.:            ||.     :.::.|
  Fly   144 GSGSSFIYGFVREHYRPNM-------ALEDCVTFVKKAVQHAIYHDGSSGGVVR-----IGIITK 196

  Fly   186 DGV 188
            ||:
  Fly   197 DGI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 34/198 (17%)
proteasome_beta_type_2 1..192 CDD:239727 34/198 (17%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 34/198 (17%)
proteasome_beta_type_6 16..203 CDD:239731 34/198 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.