DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb1

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:197 Identity:44/197 - (22%)
Similarity:78/197 - (39%) Gaps:11/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67
            |:|.:.|.||.::|:||..:....:...|..|.:|::|:.::...|..||....|:.|...:.:|
Zfish    35 TVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDTTVLGCSGFHGDCLTLTKIIEARLKMY 99

  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132
            |..|...::....|......|  |.|...||.|:..:.|.|......:...|.:.:.....|...
Zfish   100 KHSNNKSMTSGAIAAMLSTIL--YGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAG 162

  Fly   133 GYGAIFASSIYD---------RYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGV 188
            |..:.....:.|         ...|..:||.:|..:.|.......:|.|.......|.:|.|:|:
Zfish   163 GSASAMLQPLLDNQIGFKNMENVEHVPLTQEKAVQLVKDVFISAAERDVYTGDALKVCIVSKEGI 227

  Fly   189 RD 190
            ::
Zfish   228 KE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/197 (22%)
proteasome_beta_type_2 1..192 CDD:239727 44/197 (22%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 44/197 (22%)
proteasome_beta_type_1 26..237 CDD:239726 44/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.