DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psmb2

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:194 Identity:107/194 - (55%)
Similarity:145/194 - (74%) Gaps:0/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIA 65
            ||.|:||:|||||::|||...|.|||.||.|.:|:.|:|:.:|:..|||:|||.||.|:|.||:.
Zfish     1 MEYLIGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    66 LYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYA 130
            ||||||||:|||..:|:|||||||:||||||||.|.:.:||||...||.|.::|||:......:|
Zfish    66 LYKMRNGYELSPAAAANFTRKNLADYLRSRTPYHVNLLLAGYDETDGPGLYYMDYLSALAKAPFA 130

  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPI 194
            .|||||....||.|||:.|::|:.||.|:.|||:.|:.||.::||.:|||.::||||:.|:|.:
Zfish   131 AHGYGAFLTLSILDRYYRPDLTREEAVDLLKKCLEELNKRFILNLPSFTVRLIDKDGIHDMEKL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 107/192 (56%)
proteasome_beta_type_2 1..192 CDD:239727 106/190 (56%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 106/190 (56%)
PRE1 5..188 CDD:223711 101/182 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580859
Domainoid 1 1.000 210 1.000 Domainoid score I2770
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2088
Inparanoid 1 1.050 231 1.000 Inparanoid score I3423
OMA 1 1.010 - - QHG53714
OrthoDB 1 1.010 - - D1392180at2759
OrthoFinder 1 1.000 - - FOG0002770
OrthoInspector 1 1.000 - - otm26564
orthoMCL 1 0.900 - - OOG6_102061
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1010
SonicParanoid 1 1.000 - - X1860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.