DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4 and psma6b

DIOPT Version :9

Sequence 1:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001002589.1 Gene:psma6b / 436862 ZFINID:ZDB-GENE-040718-329 Length:246 Species:Danio rerio


Alignment Length:170 Identity:33/170 - (19%)
Similarity:63/170 - (37%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKMRNG 72
            |.||.::.::..||             :.::::::.....|.:.|:....:......|.:|.:.|
Zfish    55 KVPDKLLDSSTVTH-------------LFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYG 106

  Fly    73 YDLSPRESAHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAG 131
            |::    ......|.:|:..:..|      |....|.|.|.|...||::...|      |..|. 
Zfish   107 YEI----PVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCD------PAGYY- 160

  Fly   132 HGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRL 171
            .|:.|..|          .:.|.||....:|   :::|:|
Zfish   161 CGFKATAA----------GVKQTEATSFLEK---KVKKKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 33/170 (19%)
proteasome_beta_type_2 1..192 CDD:239727 33/170 (19%)
psma6bNP_001002589.1 PRE1 7..245 CDD:223711 33/170 (19%)
proteasome_alpha_type_6 8..220 CDD:239723 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.